PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6755_f_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 94aa    MW: 10748.7 Da    PI: 10.4808
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6755_f_6genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.66.8e-281059251
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly+++s
  Neem_6755_f_6 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVMIFSSTGKLYDFAS 59
                   8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.371161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-29267IPR002100Transcription factor, MADS-box
CDDcd002652.41E-38265No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVMIFSS TGKLYDFAST  60
RTKTIKQLAE LQCGKESLKV LEWYFNFIKE LCNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-17260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-17260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-17260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-17260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008357560.19e-37PREDICTED: MADS-box transcription factor 23-like
RefseqXP_008357561.19e-37PREDICTED: MADS-box transcription factor 23-like
RefseqXP_010104581.16e-37MADS-box transcription factor 27
SwissprotQ6Z6W23e-35MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A061FF381e-36A0A061FF38_THECC; AGAMOUS-like 16
TrEMBLA0A0D2S6246e-37A0A0D2S624_G
TrEMBLW9RX216e-37W9RX21_9R
STRINGGLYMA02G38091.12e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.24e-36AGAMOUS-like 16